Rabbit Polyclonal beta-Actin Antibody
| Applications | Block/Neutralize, ELISA, FC, ICC/IF, IHC, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Porcine, Avian, Hamster |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an N-terminal region of human Beta Actin. [UniProt P60709]. |
Rabbit Polyclonal Anti-ARF1 Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Rat, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARF1 antibody: synthetic peptide directed towards the middle region of human ARF1. Synthetic peptide located within the following region: MRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQA |
Rabbit anti-GNAS Polyclonal Antibody
| Applications | ICC/IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GNAS |
Germany
Japan
United Kingdom
China
