Primary Antibodies

Jump to Filters
View as table Download
PTPN13 Rabbit Polyclonal Antibody
TA336328

USD 485.00

5 Days

Rabbit Polyclonal PTPN13/PTPL1 Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A recombinant protein corresponding to amino acids 1279 to 1883 of human FAP-1 protein was used as immunogen; GenBank no. NP_542414.1.
PTPN5 Mouse Monoclonal Antibody
TA309823

USD 550.00

In Stock

Mouse Monoclonal STEP Antibody (23E5)

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Prostatic Acid Phosphatase (ACPP) Rabbit Polyclonal Antibody
AP21364AF-N

USD 330.00

2 Weeks

Prostatic Acid Phosphatase (ACPP) rabbit polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IHC, IP, R, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Acid Phosphatase isolated and purified from Human seminal plasma.
Freund’s complete adjuvant is used in the first step of the immunization procedure.
PPP4C Rabbit Polyclonal Antibody
TA327274

USD 365.00

3 Weeks

PPP4C Rabbit Polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PPP4C
SET Rabbit Polyclonal Antibody
TA342203

USD 539.00

5 Days

Rabbit polyclonal Anti-SET Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SET antibody: synthetic peptide directed towards the N terminal of human SET. Synthetic peptide located within the following region: IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT
PP2A-alpha (PPP2CA) Rabbit Polyclonal Antibody
TA360182

USD 539.00

5 Days

PPP2CA Antibody - middle region

Applications IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PPP2CA
PP1C gamma (PPP1CC) Rabbit Polyclonal Antibody
AP05036PU-N

USD 580.00

5 Days

PP1C gamma (PPP1CC) rabbit polyclonal antibody, Purified

Applications IP, WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A KLH conjugated peptide corresponding to the C-terminal region (311-323) of PP1 gamma 1 catalytic subunit.
PP1C gamma (PPP1CC) Sheep Polyclonal Antibody
AP05037PU-N

USD 580.00

5 Days

PP1C gamma (PPP1CC) sheep polyclonal antibody, Purified

Applications IP, WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A peptide conjugated to KLH
PP2A-alpha (PPP2CA) Sheep Polyclonal Antibody
AP05048PU-N

USD 580.00

5 Days

PP2A-alpha (PPP2CA) sheep polyclonal antibody, Purified

Applications IP, WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A peptide conjugated to KLH
PPP6C Sheep Polyclonal Antibody
AP05055PU-N

USD 580.00

5 Days

PPP6C sheep polyclonal antibody, Purified

Applications IP, WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A peptide conjugated to KLH