Primary Antibodies

Jump to Filters
View as table Download
ST3GAL4 Rabbit Polyclonal Antibody
TA339036

USD 539.00

5 Days

Rabbit Polyclonal Anti-ST3GAL4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ST3GAL4 antibody: synthetic peptide directed towards the middle region of human ST3GAL4. Synthetic peptide located within the following region: FDPKVENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDV