Primary Antibodies

Jump to Filters
View as table Download
LSM4 Rabbit Polyclonal Antibody
TA378154

USD 365.00

3 Weeks

LSM4 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-139 of human LSM4 (NP_036453.1).
Modifications Unmodified
LSM4 Rabbit Polyclonal Antibody
TA343783

USD 539.00

5 Days

Rabbit Polyclonal Anti-LSM4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LSM4 antibody: synthetic peptide directed towards the middle region of human LSM4. Synthetic peptide located within the following region: GRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGK