Primary Antibodies

Jump to Filters
View as table Download
EGR1 (+EGR2) Rabbit Polyclonal Antibody
AP06678PU-N

USD 465.00

3 Weeks

EGR1 (+EGR2) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 370-420 of Human Egr-1.
EGR1 Rabbit Polyclonal Antibody
TA330209

USD 539.00

5 Days

Rabbit Polyclonal Anti-EGR1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EGR1 antibody: synthetic peptide directed towards the N terminal of human EGR1. Synthetic peptide located within the following region: DNYPKLEEMMLLSNGAPQFLGAAGAPEGSGSNSSSSSSGGGGGGGGGSNS
EGR1 Rabbit Polyclonal Antibody
TA341754

USD 539.00

5 Days

Rabbit Polyclonal Anti-Egr1 Antibody

Applications IHC, WB
Reactivities Mouse, Xenopus
Conjugation Unconjugated
Immunogen The immunogen for anti-Egr1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PATTSFPSPVPTSYSSPGSSTYPSPAHSGFPSPSVATTFASVPPAFPTQV
Egr1 Rabbit Polyclonal Antibody
TA341755

USD 485.00

5 Days

Rabbit Polyclonal Anti-EGR1 Antibody

Applications IHC, WB
Reactivities Mouse, Xenopus
Conjugation Unconjugated
Immunogen The immunogen for anti-EGR1 antibody: synthetic peptide directed towards the N terminal of mouse EGR1. Synthetic peptide located within the following region: GTPEGSGGNSSSSTSSGGGGGGGSNSGSSAFNPQGEPSEQPYEHLTTESF
EGR1 Rabbit Polyclonal Antibody
TA319423

USD 765.00

5 Days

Rabbit polyclonal anti-EGR-1 antibody

Applications IHC, WB
Reactivities Human, Chimpanzee, Mouse
Conjugation Unconjugated
Immunogen This affinity-purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 94-108 (eqpyehltaesfpdi) of Human EGR-1.
EGR1 (94-108) Rabbit Polyclonal Antibody
AP07534PU-N

USD 575.00

5 Days

EGR1 rabbit polyclonal antibody, Affinity purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Chimpanzee
Conjugation Unconjugated
Immunogen This affinity-purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region near amino acids 85-115 of Human EGR-1.