Primary Antibodies

Jump to Filters
View as table Download
SUV420h1 (KMT5B) Rabbit Polyclonal Antibody
TA335571

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-SUV420H1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SUV420H1 Antibody: synthetic peptide directed towards the middle region of human SUV420H1. Synthetic peptide located within the following region: NNGFNSGSGSSSTKLKIQLKRDEENRGSYTEGLHENGVCCSDPLSLLESR
SUV420h1 (KMT5B) Rabbit Polyclonal Antibody
TA336869

USD 550.00

2 Weeks

Rabbit Polyclonal SUV420h1 Antibody

Applications FC, ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human SUV420h1 protein (between residues 450-500) [UniProt Q4FZB7]
SUV420h1 (KMT5B) Rabbit Polyclonal Antibody
TA335572

USD 485.00

5 Days

Rabbit Polyclonal Anti-SUV420H1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SUV420H1 Antibody: synthetic peptide directed towards the C terminal of human SUV420H1. Synthetic peptide located within the following region: NNGFNSGSGSSSTKLKIQLKRDEENRGSYTEGLHENGVCCSDPLSLLESR
SUV420h1 (KMT5B) Rabbit Polyclonal Antibody
TA336868

USD 550.00

5 Days

Rabbit Polyclonal SUV420h1 Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human SUV420h1 protein (between residues 100-150) [UniProt Q4FZB7]