Rabbit Polyclonal Anti-TLR6 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TLR6 |
Rabbit Polyclonal Anti-TLR6 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TLR6 |
Rabbit Polyclonal Anti-TLR6 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TLR6 |
Mouse Monoclonal TLR6 Antibody (86B1153.2)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
TLR6 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TLR6 |
TLR6 (C-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from C-terminal region of human TLR6. |
Tlr6 (C-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of mouse TLR6. |
Tlr6 (N-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the N-terminal region of mouse TLR6. |
Rabbit Polyclonal anti-TLR6 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TLR6 antibody: synthetic peptide directed towards the middle region of human TLR6. Synthetic peptide located within the following region: KCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYSKTTLKALTIEHIT |
TLR6 mouse monoclonal antibody, clone TLR6.127, Purified
Applications | FN, IF, IHC, IP |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal TLR6 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Within the range of amino acids 25-56 of human TLR6 protein were used as the immunogen. |
Toll-Like Receptor 6 Rabbit polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant Protein of TLR6 |