Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-TLR6 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TLR6

Rabbit Polyclonal Anti-TLR6 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human TLR6

Mouse Monoclonal TLR6 Antibody (86B1153.2)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

TLR6 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TLR6

TLR6 (C-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from C-terminal region of human TLR6.

Tlr6 (C-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of mouse TLR6.

Tlr6 (N-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the N-terminal region of mouse TLR6.

Rabbit Polyclonal anti-TLR6 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TLR6 antibody: synthetic peptide directed towards the middle region of human TLR6. Synthetic peptide located within the following region: KCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYSKTTLKALTIEHIT

TLR6 mouse monoclonal antibody, clone TLR6.127, Purified

Applications FN, IF, IHC, IP
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal TLR6 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Within the range of amino acids 25-56 of human TLR6 protein were used as the immunogen.

Toll-Like Receptor 6 Rabbit polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant Protein of TLR6