Primary Antibodies

Jump to Filters
View as table Download
TDO2 Mouse Monoclonal Antibody [Clone ID: OTI4G2]
TA504730

USD 478.00

In Stock

TDO2 mouse monoclonal antibody, clone OTI4G2 (formerly 4G2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
TDO2 Mouse Monoclonal Antibody [Clone ID: OTI4G2]
CF504730

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) TDO2 mouse monoclonal antibody, clone OTI4G2 (formerly 4G2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
TDO2 Mouse Monoclonal Antibody [Clone ID: OTI4G2]
TA504730S

USD 200.00

2 Days

TDO2 mouse monoclonal antibody, clone OTI4G2 (formerly 4G2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

TDO2 Rabbit Polyclonal Antibody
TA338264

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-TDO2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TDO2 antibody: synthetic peptide directed towards the N terminal of human TDO2. Synthetic peptide located within the following region: MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEK