Anti-DCXR mouse monoclonal antibody, clone OTI4D11 (formerly 4D11)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-DCXR mouse monoclonal antibody, clone OTI4D11 (formerly 4D11)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DCXR mouse monoclonal antibody, clone OTI4D11 (formerly 4D11)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-DCXR mouse monoclonal antibody, clone OTI9C9 (formerly 9C9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DCXR mouse monoclonal antibody, clone OTI9C9 (formerly 9C9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-DCXR mouse monoclonal antibody, clone OTI7D11 (formerly 7D11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
Anti-DCXR mouse monoclonal antibody, clone OTI4D11 (formerly 4D11), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
Anti-DCXR mouse monoclonal antibody, clone OTI4D11 (formerly 4D11), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
Carrier-free (BSA/glycerol-free) DCXR mouse monoclonal antibody, clone OTI7D11 (formerly 7D11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-DCXR mouse monoclonal antibody, clone OTI9C9 (formerly 9C9), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
Anti-DCXR mouse monoclonal antibody, clone OTI9C9 (formerly 9C9), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
USD 509.00
2 Weeks
Anti-DCXR mouse monoclonal antibody, clone OTI7D11 (formerly 7D11), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
Anti-DCXR mouse monoclonal antibody, clone OTI7D11 (formerly 7D11), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
Anti-DCXR mouse monoclonal antibody, clone OTI4D11 (formerly 4D11)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Goat Polyclonal Antibody against DCXR
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence GSTLPVEGGFWAC, from the C Terminus of the protein sequence according to NP_057370.1. |
Rabbit Polyclonal Anti-DCXR Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DCXR antibody: synthetic peptide directed towards the middle region of human DCXR. Synthetic peptide located within the following region: STKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKAKTM |