Primary Antibodies

Jump to Filters
View as table Download
ACAT2 Rabbit Polyclonal Antibody
TA331169

USD 485.00

5 Days

Rabbit Polyclonal Anti-ACAT2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACAT2 antibody: synthetic peptide directed towards the middle region of human ACAT2. Synthetic peptide located within the following region: SREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPR
ACAT2 Rabbit Polyclonal Antibody
TA373182

USD 365.00

3 Weeks

ACAT2 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-97 of human ACAT2 (NP_005882.2).
Modifications Unmodified