Primary Antibodies

Jump to Filters
View as table Download
c-Myb (MYB) (N-term) Rabbit Polyclonal Antibody
AP31223PU-N

USD 500.00

2 Weeks

c-Myb (MYB) (N-term) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide from human MYB (aa1-50). 
aa1-50
c-Myb (MYB) Rabbit Polyclonal Antibody
AP21138PU-N

USD 445.00

3 Weeks

c-Myb (MYB) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 491-540 of Human c-Myb.
c-Myb (MYB) Goat Polyclonal Antibody
TA302544

USD 520.00

5 Days

Goat Polyclonal Antibody against MYB / c-myb

Applications IHC, WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-QRHYNDEDPEKEKR, from the internal region of the protein sequence according to NP_005366.2.
c-Myb (MYB) Rabbit Polyclonal Antibody
TA343534

USD 539.00

5 Days

Rabbit Polyclonal Anti-MYB Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MYB antibody: synthetic peptide directed towards the N terminal of human MYB. Synthetic peptide located within the following region: YDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTD
c-Myb (MYB) Rabbit Polyclonal Antibody
TA326051

USD 380.00

In Stock

Rabbit polyclonal Myb (Phospho-Ser532) antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Myb around the phosphorylation site of serine 532 (V-E-SP-P-T).
Modifications Phospho-specific