Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-MYL6 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MYL6

Rabbit Polyclonal Anti-MYL6 Antibody - middle region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MYL6 antibody: synthetic peptide directed towards the middle region of human MYL6. Synthetic peptide located within the following region: PMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMT

MYL6 Antibody - N-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MYL6