Primary Antibodies

View as table Download

RCOR1 mouse monoclonal antibody,clone OTI9F6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RCOR1 mouse monoclonal antibody,clone OTI9F6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RCOR1 mouse monoclonal antibody,clone OTI9F6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Rabbit Polyclonal Anti-RCOR1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RCOR1 Antibody: synthetic peptide directed towards the middle region of human RCOR1. Synthetic peptide located within the following region: DEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYAS

Rabbit Polyclonal Anti-RCOR1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RCOR1 antibody: synthetic peptide directed towards the N terminal of human RCOR1. Synthetic peptide located within the following region: MVEKGPEVSGKRRGRNNAAASASAAAASAAASAACASPAATAASGAAASS

Mouse Monoclonal Anti-Co-Rest/RCOR1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated