Primary Antibodies

View as table Download

Goat Polyclonal Antibody against VDAC2 (C Terminus)

Applications IHC, PEP-ELISA, WB
Reactivities Human, Rat (Expected from sequence similarity: Mouse, Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-GHKVGLALELEA, from the C Terminus of the protein sequence according to NP_003366.2.

Anti-VDAC2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 283-294 amino acids of human voltage-dependent anion channel 2

Rabbit Polyclonal Anti-VDAC2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VDAC2 antibody: synthetic peptide directed towards the N terminal of human VDAC2. Synthetic peptide located within the following region: MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGV