Primary Antibodies

View as table Download

Rabbit polyclonal Cytochrome P450 19A1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 19A1.

Rabbit anti-UGT1A1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human UGT1A1

Anti-AKR1D1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit Polyclonal Anti-HSD17B2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human HSD17B2

Rabbit Polyclonal Anti-HSD11B2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human HSD11B2

Rabbit Polyclonal Anti-HSD17B1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human HSD17B1

Aromatase (CYP19A1) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-SRD5A2 Antibody

Applications IHC, WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen The immunogen for anti-SRD5A2 antibody: synthetic peptide directed towards the N terminal of human SRD5A2. Synthetic peptide located within the following region: MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR

Rabbit polyclonal antibody to HSD11B1 (hydroxysteroid (11-beta) dehydrogenase 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 232 and 292 of HSD11B1

Anti-ARO Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 240-255 amino acids of Human Aromatase

Anti-ARO Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 240-255 amino acids of Human Aromatase

Rabbit Polyclonal Anti-CYP11B1 Antibody

Applications IHC, WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP11B1 antibody: synthetic peptide directed towards the C terminal of human CYP11B1. Synthetic peptide located within the following region: ARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGL

Rabbit Polyclonal Anti-CYP11B1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CYP11B1

Rabbit Polyclonal antibody to WBSCR22 (Williams Beuren syndrome chromosome region 22)

Applications IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 263 of WBSCR22 (Uniprot ID#O43709)

Rabbit Polyclonal Anti-UGT2B4 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human UGT2B4