Primary Antibodies

Jump to Filters
View as table Download
MMP2 Mouse Monoclonal Antibody [Clone ID: OTI4A11]
TA806846

USD 447.00

In Stock

MMP2 mouse monoclonal antibody, clone OTI4A11 (formerly 4A11)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
MMP2 Mouse Monoclonal Antibody [Clone ID: OTI4A11]
TA806846S

USD 200.00

In Stock

MMP2 mouse monoclonal antibody, clone OTI4A11 (formerly 4A11)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

MMP2 (C-term) Rabbit Polyclonal Antibody
AP23331PU-N

USD 560.00

2 Weeks

MMP2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence at the C-terminal of human MMP2
MMP2 Rabbit Polyclonal Antibody
TA330021

USD 485.00

5 Days

Rabbit Polyclonal Anti-MMP2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MMP2 antibody: synthetic peptide directed towards the C terminal of human MMP2. Synthetic peptide located within the following region: AWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWL