Primary Antibodies

Jump to Filters
View as table Download
Aromatase (CYP19A1) (475-486) Goat Polyclonal Antibody
AP22508PU-N

USD 555.00

2 Weeks

Aromatase (CYP19A1) (475-486) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide from internal region of human CYP19A1
HEMK1 (C-term) Rabbit Polyclonal Antibody
AP52029PU-N

USD 580.00

2 Weeks

HEMK1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 311-338 amino acids from the C-terminal region of human HEMK1
HSD3B2 Rabbit Polyclonal Antibody
TA350068

USD 380.00

In Stock

Rabbit Polyclonal Anti-HSD3B2 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human HSD3B2
UGT1A6 Rabbit Polyclonal Antibody
TA351893

USD 380.00

2 Weeks

Rabbit Polyclonal Anti-UGT1A6 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human UGT1A6
UGT1A7 Rabbit Polyclonal Antibody
TA331082

USD 539.00

5 Days

Rabbit polyclonal Anti-UGT1A7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGT1A7 antibody: synthetic peptide directed towards the N terminal of human UGT1A7. Synthetic peptide located within the following region: VKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLFFSN
HSD11B1 Rabbit Polyclonal Antibody
TA338149

USD 539.00

5 Days

Rabbit Polyclonal Anti-HSD11B1 Antibody

Applications IHC, WB
Reactivities Rat, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HSD11B1 antibody: synthetic peptide directed towards the N terminal of human HSD11B1. Synthetic peptide located within the following region: QKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHI
HSD17B1 Rabbit Polyclonal Antibody
TA346185

USD 539.00

5 Days

Rabbit Polyclonal Anti-HSD17B1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HSD17B1 antibody: synthetic peptide directed towards the N terminal of human HSD17B1. Synthetic peptide located within the following region: MARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAA
UGT (UGT1A9) Rabbit Polyclonal Antibody
TA327128

USD 365.00

3 Weeks

UGT1A9 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human UGT1A9
SRD5A1 Goat Polyclonal Antibody
TA311171

USD 520.00

5 Days

Goat Anti-SRD5A1 / 5-alpha reductase 1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence ATATGVAEERLLC, from the N Terminus of the protein sequence according to NP_001038.1.