Primary Antibodies

Jump to Filters
View as table Download
HSD3B1 Rabbit Polyclonal Antibody
TA350066

USD 380.00

In Stock

Rabbit Polyclonal Anti-HSD3B1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human HSD3B1
HSD11B1 Rabbit Polyclonal Antibody
TA308504

USD 625.00

5 Days

Rabbit polyclonal antibody to HSD11B1 (hydroxysteroid (11-beta) dehydrogenase 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 232 and 292 of HSD11B1
HSD3B2 Rabbit Polyclonal Antibody
TA334658

USD 539.00

5 Days

Rabbit Polyclonal Anti-HSD3B2 Antibody

Applications IHC, WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen The immunogen for anti-HSD3B2 antibody: synthetic peptide directed towards the N terminal of human HSD3B2. Synthetic peptide located within the following region: GWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQN
HSD11B1 Rabbit Polyclonal Antibody
TA312234

USD 380.00

In Stock

Rabbit polyclonal anti-HSD11B1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human HSD11B1.
HSD3B2 Rabbit Polyclonal Antibody
TA350068

USD 380.00

In Stock

Rabbit Polyclonal Anti-HSD3B2 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human HSD3B2
HSD11B1 Rabbit Polyclonal Antibody
TA338149

USD 539.00

5 Days

Rabbit Polyclonal Anti-HSD11B1 Antibody

Applications IHC, WB
Reactivities Rat, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HSD11B1 antibody: synthetic peptide directed towards the N terminal of human HSD11B1. Synthetic peptide located within the following region: QKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHI