Primary Antibodies

Jump to Filters
View as table Download
GLI1 Mouse Monoclonal Antibody [Clone ID: OTI4C1]
TA803833S

USD 200.00

2 Days

GLI1 mouse monoclonal antibody, clone OTI4C1 (formerly 4C1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

GLI1 Mouse Monoclonal Antibody [Clone ID: OTI1C1]
TA804205S

USD 200.00

2 Days

GLI1 mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

BMP7 Rabbit Polyclonal Antibody
TA326853

USD 365.00

2 Weeks

Rabbit anti-BMP7 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human BMP7
WNT1 Rabbit Polyclonal Antibody
TA314674

USD 380.00

In Stock

Rabbit polyclonal anti-WNT1 antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human WNT1.
WNT7B Rabbit Polyclonal Antibody
TA344089

USD 539.00

5 Days

Rabbit Polyclonal Anti-WNT7B Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT7B antibody: synthetic peptide directed towards the middle region of human WNT7B. Synthetic peptide located within the following region: WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM
WNT6 Rabbit Polyclonal Antibody
TA317519

USD 515.00

5 Days

WNT6 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Dog, Gorilla, Human, Rabbit, Gibbon, Horse (Predicted: Monkey, Mouse, Rat, Hamster)
Conjugation Unconjugated
Immunogen WNT6 antibody was raised against synthetic 18 amino acid peptide from internal region of human WNT6. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Elephant, Bovine, Dog, Bat, Horse, Rabbit, Opossum (100%); Marmoset, Mouse, Rat, Hamster, Platypus (94%); Turkey, Chicken (83%).
WNT2 Rabbit Polyclonal Antibody
TA341208

USD 515.00

5 Days

Rabbit Polyclonal Anti-WNT2 Antibody (Internal)

Applications IHC
Reactivities Human (Predicted: Mouse, Rat, Bat, Bovine, Dog, Hamster, Pig, Rabbit, Sheep, Chicken, Guinea Pig)
Conjugation Unconjugated
Immunogen WNT2 / IRP antibody was raised against synthetic 15 amino acid peptide from internal region of human WNT2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Baboon, Monkey, Marmoset (100%); Galago, Mouse, Rat, Ferret, Sheep, Hamster, Elephant, Panda, Dog, Bovine, Cat, Bat, Rabbit, Pig, Opossum, Guinea pig, Turkey, Chicken, Armadillo, Platypus (93%); Horse (87%).