Primary Antibodies

Jump to Filters
View as table Download
Rab5 (RAB5A) Goat Polyclonal Antibody
AB0009-200

USD 355.00

In Stock

Goat Polyclonal Anti-Rab5a Antibody

Applications IF, IHC, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 115 aa to the C-terminus of mouse Rab5a produced in E. coli.
Rab5 (RAB5A) Rabbit Polyclonal Antibody
TA324884

USD 580.00

5 Days

Rabbit polyclonal Rab5 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This Rab5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 182-211 amino acids from the C-terminal region of human Rab5.
Rab5 (RAB5A) Rabbit Polyclonal Antibody
TA342212

USD 539.00

5 Days

Rabbit polyclonal Anti-RAB5A Antibody

Applications IHC, WB
Reactivities Human, Mouse, Zebrafish
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB5A antibody: synthetic peptide directed towards the middle region of human RAB5A. Synthetic peptide located within the following region: KTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCS
Rab5 (RAB5A) Rabbit Polyclonal Antibody
TA326977

USD 365.00

3 Weeks

Rabbit anti-RAB5A Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RAB5A