Primary Antibodies

View as table Download

Rabbit polyclonal PCNA Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human (Predicted: Mouse, Rat, Bovine, Chicken, Hamster, Monkey)
Conjugation Unconjugated
Immunogen This PCNA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 89-117 amino acids from the Central region of human PCNA.

Rabbit polyclonal anti-FEN1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FEN1.

Rabbit Polyclonal Anti-HMGB1 Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen HMGB1 antibody was raised against a 19 amino acid peptide near the center of human HMGB1.

Rabbit Polyclonal UNG1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen UNG1 antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human UNG1.

Rabbit Polyclonal UNG1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen UNG1 antibody was raised against a 13 amino acid peptide from near the amino terminus of human UNG1.

Rabbit Polyclonal Anti-PARP2 Antibody

Applications IF, WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PARP2 antibody: synthetic peptide directed towards the middle region of human PARP2. Synthetic peptide located within the following region: LLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAHPEA

Rabbit polyclonal anti-MUTYH antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MUTYH.