Rabbit Polyclonal MUC-1 Antibody
| Applications | FC, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Rabbit Polyclonal Niemann-Pick C1 Antibody
| Applications | Electron Microscopy, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Porcine, Hamster, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the C-terminal region of human Niemann-Pick C. [UniProt# O15118] |
Rabbit Polyclonal Aquaporin-2 Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Bovine, Human, Mouse, Porcine, Rat, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to a C-terminus portion of the rat protein (within residues 200-300). [Swiss-Prot# P34080] |
Germany
Japan
United Kingdom
China
