Primary Antibodies

Jump to Filters
View as table Download
Glutathione Peroxidase 2 (GPX2) Rabbit Polyclonal Antibody
TA308741

USD 495.00

In Stock

Rabbit polyclonal antibody to Glutathione Peroxidase 2 (glutathione peroxidase 2 (gastrointestinal))

Applications IHC, WB
Reactivities Human (Predicted: Dog, Pig, Rabbit, Chimpanzee, Bovine, Rhesus Monkey, X. tropicalis)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 54 of GPX2
Glutathione Peroxidase 2 (GPX2) Rabbit Polyclonal Antibody
TA346318

USD 539.00

5 Days

Rabbit Polyclonal Anti-GPX2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPX2 antibody: synthetic peptide directed towards the middle region of human GPX2. Synthetic peptide located within the following region: GGGYQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKLII