Rabbit Polyclonal anti-OR13C5 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR13C5 antibody: synthetic peptide directed towards the middle region of human OR13C5. Synthetic peptide located within the following region: CGTIFLMYMKPKSQETLNSDDLDATDKLIFIFYRVMTPMMNPLIYSLRNK |
Rabbit Polyclonal Anti-OR13C5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR13C5 antibody: synthetic peptide directed towards the N terminal of human OR13C5. Synthetic peptide located within the following region: CYTTTSIPSTLVSFLSERKTISLSGCAVQMFLSLAMGTTECVLLGVMAFD |
Rabbit Polyclonal Anti-OR13C5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR13C5 antibody is: synthetic peptide directed towards the N-terminal region of Human OR13C5. Synthetic peptide located within the following region: ILISILDPHLHTPMYFFLGNLSFLDICYTTTSIPSTLVSFLSERKTISLS |
Rabbit Polyclonal Anti-OR13C5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR13C5 Antibody: synthetic peptide directed towards the N terminal of human OR13C5. Synthetic peptide located within the following region: ICYTTTSIPSTLVSFLSERKTISLSGCAVQMFLSLAMGTTECVLLGVMAF |
Germany
Japan
United Kingdom
China