Primary Antibodies

Jump to Filters
View as table Download
RPS27L Rabbit Polyclonal Antibody
TA315441

USD 380.00

4 Weeks

Rabbit polyclonal anti-RS27L antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human RS27L.
RPS27L Rabbit Polyclonal Antibody
TA345097

USD 539.00

5 Days

Rabbit Polyclonal Anti-RPS27L Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPS27L antibody: synthetic peptide directed towards the N terminal of human RPS27L. Synthetic peptide located within the following region: MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHA