Primary Antibodies

Jump to Filters
View as table Download
MGAT2 Rabbit Polyclonal Antibody
TA335833

USD 485.00

5 Days

Rabbit Polyclonal Anti-MGAT2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MGAT2 Antibody: synthetic peptide directed towards the middle region of human MGAT2. Synthetic peptide located within the following region: PKNAALKLGCINAEYPDSFGHYREAKFSQTKHHWWWKLHFVWERVKILRD
MGAT2 Rabbit Polyclonal Antibody
TA335834

USD 539.00

5 Days

Rabbit Polyclonal Anti-MGAT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MGAT2 Antibody: synthetic peptide directed towards the middle region of human MGAT2. Synthetic peptide located within the following region: YAGLILFLEEDHYLAPDFYHVFKKMWKLKQQECPECDVLSLGTYSASRSF