Primary Antibodies

Jump to Filters
View as table Download
ADI1 (Center) Rabbit Polyclonal Antibody
AP50094PU-N

USD 580.00

2 Weeks

ADI1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 87-116 amino acids from the Central region of human ADI1
ADI1 Rabbit Polyclonal Antibody
TA331241

USD 539.00

5 Days

Rabbit Polyclonal Anti-ADI1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ADI1 antibody is: synthetic peptide directed towards the N-terminal region of Human ADI1. Synthetic peptide located within the following region: YMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKI
ADI1 Rabbit Polyclonal Antibody
TA331242

USD 539.00

5 Days

Rabbit Polyclonal Anti-ADI1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ADI1 antibody is: synthetic peptide directed towards the middle region of Human ADI1. Synthetic peptide located within the following region: DKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEK