Germany
Japan
United Kingdom
China
Clathrin light chain (CLTB) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein from human CLTB |
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-CLTA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLTA antibody: synthetic peptide directed towards the C terminal of human CLTA. Synthetic peptide located within the following region: KELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTEWERVARLCDF |
Rabbit Polyclonal Anti-CLTA Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Clta antibody is: synthetic peptide directed towards the C-terminal region of Rat Clta. Synthetic peptide located within the following region: EQAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLIS |
Rabbit Polyclonal Anti-CLTB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLTB antibody: synthetic peptide directed towards the C terminal of human CLTB. Synthetic peptide located within the following region: ADIIGYVASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLR |
Active filters
Target Symbol
- CLATHRIN LIGHT CHAIN
Antibody Hosts
- Rabbit
Pathways
- Huntington's disease