Primary Antibodies

Jump to Filters
View as table Download
DGAT2L4 (AWAT2) (C-term) Rabbit Polyclonal Antibody
AP50318PU-N

USD 580.00

2 Weeks

DGAT2L4 (AWAT2) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 306-335 amino acids from the C-terminal region of human AWAT2
DGAT2L4 (AWAT2) Rabbit Polyclonal Antibody
TA335288

USD 539.00

5 Days

Rabbit Polyclonal Anti-DGAT2L4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DGAT2L4 antibody: synthetic peptide directed towards the C terminal of human DGAT2L4. Synthetic peptide located within the following region: GEPLPMPKIENPSQEIVAKYHTLYIDALRKLFDQHKTKFGISETQELEII