Primary Antibodies

Jump to Filters
View as table Download
CA5B Rabbit Polyclonal Antibody
TA374174

USD 365.00

3 Weeks

CA5B Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-317 of human CA5B (NP_009151.1).
Modifications Unmodified
CA5B Rabbit Polyclonal Antibody
TA367918

USD 380.00

4 Weeks

CA5B rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CA5B
CA5B Rabbit Polyclonal Antibody
TA372155

USD 380.00

4 Weeks

CA5B rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CA5B
CA5B Rabbit Polyclonal Antibody
TA315166

USD 380.00

In Stock

Rabbit polyclonal anti-CA5B antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CA5B.
CA5B Rabbit Polyclonal Antibody
TA340162

USD 539.00

5 Days

Rabbit Polyclonal Anti-CA5B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CA5B antibody: synthetic peptide directed towards the N terminal of human CA5B. Synthetic peptide located within the following region: WRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPL