Biotinylated Anti-Human M-CSF Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Biotin |
Immunogen | E.coli derived Recombinant Human M-CSF |
Biotinylated Anti-Human M-CSF Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Biotin |
Immunogen | E.coli derived Recombinant Human M-CSF |
Rabbit Polyclonal Anti-CSF1 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CSF1 antibody: synthetic peptide directed towards the middle region of human CSF1. Synthetic peptide located within the following region: SGSVLPLGELEGRRSTRDRRSPAEPEGGPASEGAARPLPRFNSVPLTDTG |
Rabbit Polyclonal Anti-CSF1 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CSF1 antibody: synthetic peptide directed towards the middle region of human CSF1. Synthetic peptide located within the following region: MAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPRSTCQSFEPP |
Rabbit Polyclonal Anti-CSF1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CSF1 antibody: synthetic peptide directed towards the N terminal of human CSF1. Synthetic peptide located within the following region: PPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQME |