Primary Antibodies

Jump to Filters
View as table Download
CD13 (ANPEP) Rabbit Polyclonal Antibody
TA350805

USD 380.00

In Stock

Rabbit Polyclonal Anti-ANPEP Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ANPEP
CD13 (ANPEP) Rabbit Polyclonal Antibody
TA332824

USD 365.00

3 Weeks

Rabbit anti-ANPEP Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ANPEP
CD13 (ANPEP) Rabbit Polyclonal Antibody
TA343101

USD 539.00

5 Days

Rabbit Polyclonal Anti-ANPEP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANPEP antibody: synthetic peptide directed towards the N terminal of human ANPEP. Synthetic peptide located within the following region: VGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLA