Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-BACE1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-BACE1 antibody: synthetic peptide directed towards the N terminal of human BACE1. Synthetic peptide located within the following region: GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY

Anti-BACE1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human beta-site APP-cleaving enzyme 1
TA324168 is a possible alternative to TA349256.

Rabbit Polyclonal Anti-Bace1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Bace1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: YTPIRREWYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDSGTTNLRLPKK