Primary Antibodies

View as table Download

Rabbit Polyclonal ErbB3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. In vivo generated recombinant protein fragment

Anti-ERBB3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian)

Rabbit polyclonal anti-HER3 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human HER3.

ErbB 3 (ERBB3) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 1250-1300 of Human ErbB-3.

Rabbit polyclonal Anti-PPID Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPID antibody: synthetic peptide directed towards the middle region of human PPID. Synthetic peptide located within the following region: AECGELKEGDDGGIFPKDGSGDSHPDFPEDADIDLKDVDKILLITEDLKN

Anti-ERBB3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian)

Rabbit polyclonal anti-HER3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Anti-HER3 whole rabbit serum was prepared by repeated immunizations with a HER3 fusion protein corresponding to amino acids 1283 to 1323 (40 amino acids) at the carboxy-terminus of human HER3.

Rabbit polyclonal Anti-PPID Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPID antibody: synthetic peptide directed towards the N terminal of human PPID. Synthetic peptide located within the following region: CPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSM

ErbB 3 (ERBB3) rabbit polyclonal antibody, Aff - Purified

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen Synhesized non-phosphopeptide derived from human Her3/ErbB3 around the phosphorylation site of Tyr1289 (Q-G-YPE-E)

ErbB 3 (ERBB3) rabbit polyclonal antibody, Aff - Purified

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen Synhesized non-phosphopeptide derived from human Her3/ErbB3 around the phosphorylation site of Tyr1289 (Q-G-YPE-E)

Cyclophilin 40 (PPID) (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human PPID

Rabbit anti c-erbB3 Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated

Rabbit anti C-erbB3/HER3 (pY1283) Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated

Rabbit anti C-erbB3/HER3 (Paired Y1283) Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated

Rabbit anti C-erbB3/HER3 Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated