Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-NR1I2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR1I2 antibody: synthetic peptide directed towards the N terminal of human NR1I2. Synthetic peptide located within the following region: KKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDA

Rabbit polyclonal anti-NR1I2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NR1I2.

PXR (NR1I2) (Center) rabbit polyclonal antibody

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 100-127 aa selected from the Center region of human NR1I2

Rabbit Polyclonal Anti-NR1I2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR1I2 antibody: synthetic peptide directed towards the N terminal of human NR1I2. Synthetic peptide located within the following region: EVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGY

Rabbit Polyclonal Anti-NR1I2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR1I2 antibody: synthetic peptide directed towards the C terminal of human NR1I2. Synthetic peptide located within the following region: PQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGI

Rabbit Polyclonal Anti-NR1I2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NR1I2 antibody is: synthetic peptide directed towards the N-terminal region of Human NR1I2. Synthetic peptide located within the following region: AELASNHPRGPEANLEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVG

Rabbit Polyclonal Anti-NR1I2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR1I2 antibody: synthetic peptide directed towards the N terminal of human NR1I2. Synthetic peptide located within the following region: MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATG