Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit polyclonal anti-CMKLR1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CMKLR1. |
Rabbit Polyclonal Anti-CMKLR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CMKLR1 antibody: synthetic peptide directed towards the C terminal of human CMKLR1. Synthetic peptide located within the following region: KKFKVALFSRLVNALSEDTGHSSYPSHRSFTKMSSMNERTSMNERETGML |
Rabbit Polyclonal Anti-CMKLR1 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human (Predicted: Monkey, Rabbit) |
| Conjugation | Unconjugated |
| Immunogen | CHEMR23 / CMKLR1 antibody was raised against synthetic 19 amino acid peptide from C-terminal cytoplasmic domain of human CMKLR1. Percent identity with other species by BLAST analysis: Human, Gibbon (100%); Marmoset, Rabbit (95%); Horse (84%). |
CMKLR1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CMKLR1 |
Active filters
Target Symbol
- CMKLR1
Antibody Hosts
- Rabbit
Families
- GPCR