Primary Antibodies

View as table Download

Glucose 6 phosphate isomerase (GPI) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 452~481 amino acids from the C-terminal region of human GPI

Rabbit Polyclonal Glucose 6 phosphate isomerase Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal Anti-GPI Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPI antibody: synthetic peptide directed towards the C terminal of human GPI. Synthetic peptide located within the following region: SFDQWGVELGKQLAKKIEPELDGSAQVTSHDASTNGLINFIKQQREARVQ

Rabbit Polyclonal Anti-GPI Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPI antibody: synthetic peptide directed towards the C terminal of human GPI. Synthetic peptide located within the following region: EALMRGKSTEEARKELQAAGKSPEDLERLLPHKVFEGNRPTNSIVFTKLT