Primary Antibodies

Jump to Filters
View as table Download
GALE (Center) Rabbit Polyclonal Antibody
AP17410PU-N

USD 580.00

2 Weeks

GALE (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the Center region of human GALE
GALE Rabbit Polyclonal Antibody
TA334924

USD 539.00

5 Days

Rabbit Polyclonal Anti-GALE Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GALE antibody: synthetic peptide directed towards the N terminal of human GALE. Synthetic peptide located within the following region: AEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRR
GALE Rabbit Polyclonal Antibody
TA334925

USD 539.00

5 Days

Rabbit Polyclonal Anti-GALE Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GALE antibody: synthetic peptide directed towards the middle region of human GALE. Synthetic peptide located within the following region: PQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKG