Primary Antibodies

Jump to Filters
View as table Download
Dnmt2 (TRDMT1) Rabbit Polyclonal Antibody
TA350651

USD 380.00

In Stock

Rabbit Polyclonal Anti-TRDMT1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human TRDMT1
Dnmt2 (TRDMT1) Rabbit Polyclonal Antibody
TA347310

USD 430.00

5 Days

Rabbit Polyclonal DNMT2 Antibody

Applications ELISA, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DNMT2 antibody: mouse Dnmt2 (DNA methyltransferase 2), using a KLH-conjugated synthetic peptide containing an amino acid sequence from the N-terminal part of the protein (1).
Dnmt2 (TRDMT1) Rabbit Polyclonal Antibody
TA346721

USD 539.00

5 Days

Rabbit Polyclonal Anti-TRDMT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRDMT1 antibody: synthetic peptide directed towards the N terminal of human TRDMT1. Synthetic peptide located within the following region: MILMSPPCQPFTRIGRQGDMTDSRTNSFLHILDILPRLQKLPKYILLENV