Primary Antibodies

Jump to Filters
View as table Download
PPP4C Rabbit Polyclonal Antibody
TA327274

USD 365.00

3 Weeks

PPP4C Rabbit Polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PPP4C
PPP4C Rabbit Polyclonal Antibody
AP05056PU-N

USD 580.00

5 Days

PPP4C rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A PP X/C peptide conjugated to KLH
PPP4C Rabbit Polyclonal Antibody
TA344304

USD 539.00

5 Days

Rabbit Polyclonal Anti-PPP4C Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP4C antibody: synthetic peptide directed towards the middle region of human PPP4C. Synthetic peptide located within the following region: TVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKP