Primary Antibodies

Jump to Filters
View as table Download
CYP1A1 Rabbit Polyclonal Antibody
TA351483

USD 380.00

2 Weeks

Rabbit Polyclonal Anti-CYP1A1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CYP1A1
CYP26C1 Rabbit Polyclonal Antibody
TA316352

USD 380.00

4 Weeks

Rabbit polyclonal anti-CP26C antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human CP26C.
ALDH1A2 Rabbit Polyclonal Antibody
TA342735

USD 539.00

5 Days

Rabbit Polyclonal Anti-ALDH1A2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Aldh1a2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Aldh1a2. Synthetic peptide located within the following region: ALMVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEV
DHRS4 Rabbit Polyclonal Antibody
TA343204

USD 539.00

5 Days

Rabbit Polyclonal Anti-DHRS4 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Dhrs4 antibody is: synthetic peptide directed towards the middle region of Mouse Dhrs4. Synthetic peptide located within the following region: RRLAEDGAHVVVSSRKQQNVDRAVATLQGEGLSVTGIVCHVGKAEDREKL
Cytochrome P450 2B6 (CYP2B6) Rabbit Polyclonal Antibody
TA346223

USD 539.00

5 Days

Rabbit Polyclonal Anti-CYP2B6 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2B6 antibody: synthetic peptide directed towards the middle region of human CYP2B6. Synthetic peptide located within the following region: QLFELFSGFLKYFPGAHRQVYKNLQEINAYIGHSVEKHRETLDPSAPKDL
LRAT Rabbit Polyclonal Antibody
TA347620

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-LRAT Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-LRAT Antibody: A synthesized peptide derived from human LRAT
CYP1A1 Rabbit Polyclonal Antibody
TA347969

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Cytochrome P450 1A1/2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Cytochrome P450 1A1/2 Antibody: A synthesized peptide derived from human Cytochrome P450 1A1/2