Primary Antibodies

Jump to Filters
View as table Download
HSPA1L Rabbit Polyclonal Antibody
TA335710

USD 539.00

5 Days

Rabbit Polyclonal Anti-HSPA1L Antibody

Applications WB
Reactivities Human, Rat, Lamprey
Conjugation Unconjugated
Immunogen The immunogen for Anti-HSPA1L Antibody: synthetic peptide directed towards the C terminal of human HSPA1L. Synthetic peptide located within the following region: DEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD