Primary Antibodies

View as table Download

Rabbit polyclonal WAVE1 (Ab-125) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human WAVE1 around the phosphorylation site of tyrosine 125 (E-T-YP-D-V).

Rabbit polyclonal WAVE1 (Tyr125) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human WAVE1 around the phosphorylation site of tyrosine 125 (E-T-YP-D-V).
Modifications Phospho-specific

WASF1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence TPYRDDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRKQKQKNLDRP