Primary Antibodies

View as table Download

BMP8A Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human BMP8A

BMP5 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human BMP5

WNT5B Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human WNT5B

PRKX Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PRKX

CSNK1A1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CSNK1A1

SUFU Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SUFU

SUFU Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle terminal region of human SUFU

SHH Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SHH

Rabbit Polyclonal Anti-FBXW11 Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FBXW11 antibody: synthetic peptide directed towards the N terminal of human FBXW11. Synthetic peptide located within the following region: CLQSMPSVRCLQISNGTSSVIVSRKRPSEGNYQKEKDLCIKYFDQWSESD

WNT9A (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence at the C-terminal of human WNT9A

Rabbit polyclonal GSK3beta (Ser9) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human GSK3β
Modifications Phospho-specific

Suppressor of Fused (SUFU) pSer342 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of Serine 342 derived from Human Sufu

Suppressor of Fused (SUFU) pSer342 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of Serine 342 derived from Human Sufu

Rabbit anti Glycogen Synthase Kinase 3b (GSK3b) Polyclonal Antibody

Reactivities Human, Mouse, Rat, Bovine
Conjugation Unconjugated