Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-COL4A3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COL4A3 antibody: synthetic peptide directed towards the N terminal of human COL4A3. Synthetic peptide located within the following region: GPPGVPGSPGSSRPGLRGAPGWPGLKGSKGERGRPGKDAMGTPGSPGCAG |
Collagen IV (COL4A1) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Collagen Type IV from Human and Bovine placenta. |
Rabbit Polyclonal Anti-COL4A3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COL4A3 antibody: synthetic peptide directed towards the middle region of human COL4A3. Synthetic peptide located within the following region: DPGQPGPPGEQGPPGRCIEGPRGAQGLPGLNGLKGQQGRRGKTGPKGDPG |
Rabbit polyclonal Collagen IV a3 (Cleaved-Pro1426) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Collagen IV a3. |
Rabbit Polyclonal Anti-Collagen IV Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Collagen IV Antibody: A synthesized peptide derived from human Collagen IV |
Rabbit polyclonal Collagen IV a3 (Cleaved-Leu1425) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Collagen IV a3. |
Active filters
Target Symbol
- COLLAGEN IV
Antibody Hosts
- Rabbit
Isotypes
- IgG
Clonalities
- Polyclonal