Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal Gli1 Antibody
| Applications | ChIP, ELISA, FC, ICC/IF, IHC, Immunoblotting, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made toward the C-terminus portion of the human Gli1 protein (between residues 800-850) [UniProt P08151] |
Rabbit Polyclonal Anti-SUFU Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SUFU antibody: synthetic peptide directed towards the middle region of human SUFU. Synthetic peptide located within the following region: LQILLTEEFVEKMLEDLEDLTSPEEFKLPKEYSWPEKKLKVSILPDVVFD |
Rabbit Polyclonal Anti-SUFU Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SUFU Antibody: synthetic peptide directed towards the middle region of human SUFU. Synthetic peptide located within the following region: NGQGILELLRTVPIAGGPWLITDMRRGETIFEIDPHLQERVDKGIETDGS |
Rabbit Polyclonal Anti-SUFU Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SUFU Antibody: synthetic peptide directed towards the N terminal of human SUFU. Synthetic peptide located within the following region: HAIYGECRRLYPDQPNPLQVTAIVKYWLGGPDPLDYVSMYRNVGSPSANI |
SUFU Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SUFU |
SUFU Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle terminal region of human SUFU |
Suppressor of Fused (SUFU) pSer342 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of Serine 342 derived from Human Sufu |
Suppressor of Fused (SUFU) pSer342 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of Serine 342 derived from Human Sufu |
Active filters
Antibody Hosts
- Rabbit
Clonalities
- Polyclonal
Families
- Transcription Factors
Pathways
- Hedgehog signaling pathway