Rabbit polyclonal anti-BMP8A antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human BMP8A. |
Rabbit polyclonal anti-BMP8A antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human BMP8A. |
Rabbit Polyclonal Anti-BMP8A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BMP8A antibody is: synthetic peptide directed towards the middle region of Human BMP8A. Synthetic peptide located within the following region: VRPLRRRQPKKTNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLG |
Rabbit Polyclonal Anti-BMP8A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BMP8A antibody is: synthetic peptide directed towards the N-terminal region of Human BMP8A. Synthetic peptide located within the following region: RPPPGCPQRRLGARERRDVQREILAVLGLPGRPRPRAPPAASRLPASAPL |
BMP8A Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human BMP8A |