Primary Antibodies

Jump to Filters
View as table Download
ADAMTS18 Rabbit Polyclonal Antibody
TA321964

USD 380.00

2 Weeks

Anti-ADAMTS18 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human ADAM metallopeptidase with thrombospondin type 1 motif, 18
ADAMTS18 Rabbit Polyclonal Antibody
TA316206

USD 380.00

In Stock

Rabbit polyclonal anti-ADAMTS18 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ADAMTS18.
ADAMTS18 Rabbit Polyclonal Antibody
TA350731

USD 380.00

In Stock

Rabbit Polyclonal Anti-ADAMTS18 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ADAMTS18
ADAMTS18 Rabbit Polyclonal Antibody
TA337618

USD 539.00

5 Days

Rabbit Polyclonal Anti-ADAMTS18 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADAMTS18 antibody: synthetic peptide directed towards the N terminal of human ADAMTS18. Synthetic peptide located within the following region: FYQGFIRNDSSSSVAVSTCAGLSGLIRTRKNEFLISPLPQLLAQEHNYSS