Primary Antibodies

Jump to Filters
View as table Download
GATM Rabbit Polyclonal Antibody
TA346701

USD 539.00

5 Days

Rabbit Polyclonal Anti-GATM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GATM antibody: synthetic peptide directed towards the middle region of human GATM. Synthetic peptide located within the following region: PCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPDYRVHIISFKDPN
GATM (N-term) Rabbit Polyclonal Antibody
AP51788PU-N

USD 580.00

2 Weeks

GATM (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected between amino acids 70 and 100 of Human Glycine amidinotransferase