Rabbit polyclonal antibody to SH3GL1 (SH3-domain GRB2-like 1)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Chicken, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 152 and 368 of EEN (Uniprot ID#Q99961) |
Rabbit polyclonal Anti-SH3GL1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SH3GL1 antibody: synthetic peptide directed towards the N terminal of human SH3GL1. Synthetic peptide located within the following region: LNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGES |
SH3GL1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SH3GL1 |
Germany
Japan
United Kingdom
China
